Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MIER3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $728.30
Specifications
| Antigen | MIER3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
MIER3 Polyclonal specifically detects MIER3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| MIER3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 166968 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HETSDFFPRPLRSNTACDGDKESEVEDVETDSGNSPEDLRKEIMIGLQYQAEIPPYLGEYDGNEK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954, mesoderm induction early response 1, family member 3, mesoderm induction early response protein 3, mi-er3 | |
| MIER3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title