Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMADHC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | MMADHC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17958520
|
Novus Biologicals
NBP17958520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179585
|
Novus Biologicals
NBP179585 |
100 μL |
Each for $487.50
|
|
|||||
Description
MMADHC Polyclonal specifically detects MMADHC in Human samples. It is validated for Western Blot.Specifications
| MMADHC | |
| Polyclonal | |
| Rabbit | |
| NP_056517 | |
| 27249 | |
| Synthetic peptide directed towards the N terminal of human C2orf25. Peptide sequence GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cblD, chromosome 2 open reading frame 25, methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria, mitochondrial, protein C2orf25, mitochondrial | |
| MMADHC | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title