Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMADHC Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | MMADHC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17958520
|
Novus Biologicals
NBP17958520UL |
20 μL |
Each for $152.22
|
|
NBP179585
|
Novus Biologicals
NBP179585 |
100 μL |
Each for $436.00
|
|
Description
MMADHC Polyclonal specifically detects MMADHC in Human samples. It is validated for Western Blot.Specifications
| MMADHC | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| cblD, chromosome 2 open reading frame 25, methylmalonic aciduria (cobalamin deficiency) cblD type, with homocystinuria, mitochondrial, protein C2orf25, mitochondrial | |
| MMADHC | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_056517 | |
| 27249 | |
| Synthetic peptide directed towards the N terminal of human C2orf25. Peptide sequence GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title