Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MMP-19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | MMP-19 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15709420
|
Novus Biologicals
NBP15709420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157094
|
Novus Biologicals
NBP157094 |
100 μL |
Each for $487.50
|
|
|||||
Description
MMP-19 Polyclonal specifically detects MMP-19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MMP-19 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q99542 | |
| 4327 | |
| Synthetic peptides corresponding to MMP19 (matrix metallopeptidase 19) The peptide sequence was selected from the C terminal of MMP19. Peptide sequence IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Angiogenesis, Cancer, Extracellular Matrix | |
| EC 3.4.24.-, matrix metallopeptidase 19, matrix metalloproteinase 18, matrix metalloproteinase 19, Matrix metalloproteinase RASI, Matrix metalloproteinase-18, matrix metalloproteinase-19, MMP-18, MMP18MMP-19, RASI, RASI-1 | |
| MMP19 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title