Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MOS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | MOS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB15885120
|
Novus Biologicals
NBP15821220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP158212
|
Novus Biologicals
NBP158212 |
100 μL |
Each for $487.50
|
|
|||||
Description
MOS Polyclonal specifically detects MOS in Human, Bovine samples. It is validated for Western Blot.Specifications
| MOS | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| c-mos, EC 2.7.11, EC 2.7.11.1, MGC119962, MGC119963, MSV, oncogene MOS, Moloney murine sarcoma virus, Oocyte maturation factor mos, Proto-oncogene c-Mos, proto-oncogene serine/threonine-protein kinase mos, v-mos Moloney murine sarcoma viral oncogene homolog | |
| MOS | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P00540 | |
| 4342 | |
| Synthetic peptides corresponding to MOS(v-mos Moloney murine sarcoma viral oncogene homolog) The peptide sequence was selected from the middle region of MOS. Peptide sequence LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title