MRP1 Antibody (IU5C1) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB11057131T	Novus Biologicals NB11057131SS	0.025 mL
NB11057131	Novus Biologicals NB11057131	0.1 mL

Description

MRP1 Monoclonal specifically detects MRP1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MRP1
• Dilution: Western Blot 1:250 - 1:500, Immunohistochemistry 1:200, Immunocytochemistry/Immunofluorescence reported in scientific literature, Immunohistochemistry-Paraffin 1:200
• Classification: Monoclonal
• Form: Ascites
• Regulatory Status: RUO
• Target Species: Human, Mouse
• Gene Accession No.: P33527
• Gene ID (Entrez): 4363
• Immunogen: A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of human MRP1. [Swiss-Prot# P33527]
• Primary or Secondary: Primary
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 172 kDa

• Clone: IU5C1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Mouse
• Research Discipline: ABC Transporters, Amino Acids Drugs and other small molecules, Cancer, Lipid and Metabolism, Plasma Membrane Markers, Signal Transduction
• Formulation: PBS with 0.1% Sodium Azide
• Gene Alias: ABC29, ABCC, ATP-binding cassette sub-family C member 1, ATP-binding cassette, sub-family C (CFTR/MRP), member 1, EC 3.6.3, EC 3.6.3.44, GS-X, Leukotriene C(4) transporter, LTC4 transporter, MRP1DKFZp781G125, MRPDKFZp686N04233, multidrug resistance associated protein 1, multidrug resistance protein, multidrug resistance-associated protein 1, multiple drug resistance protein 1, multiple drug resistance-associated protein
• Gene Symbols: ABCC1
• Isotype: IgG1
• Purification Method: Protein G purified
• Test Specificity: Human and mouse. Immunogen has 96% homology to rat, primate, and feline, 88% homology to chicken, 87% homology to bovine, 72% homology to Drosophila melanogaster.

For Research Use Only