Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MRTO4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP188334 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP188334 0.1 mL
NB418163 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP188334 Supplier Novus Biologicals Supplier No. NBP188334
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MRTO4 Polyclonal specifically detects MRTO4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen MRTO4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C1orf33, chromosome 1 open reading frame 33, dJ657E11.4, mRNA turnover 4 homolog (S. cerevisiae), mRNA turnover protein 4 homolog, MRT4, mRNA turnover 4, homolog, MRT4, mRNA turnover 4, homolog (S. cerevisiae), MRT460S acidic ribosomal protein PO
Gene Symbols MRTO4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVV
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 51154
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.