Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    MRTO4 Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP188334
Description
MRTO4 Polyclonal specifically detects MRTO4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| MRTO4 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| C1orf33, chromosome 1 open reading frame 33, dJ657E11.4, mRNA turnover 4 homolog (S. cerevisiae), mRNA turnover protein 4 homolog, MRT4, mRNA turnover 4, homolog, MRT4, mRNA turnover 4, homolog (S. cerevisiae), MRT460S acidic ribosomal protein PO | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | 
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MRTO4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVV | |
| 0.1 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 51154 | |
| Human | |
| IgG | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            For Research Use Only
Spot an opportunity for improvement?Share a Content Correction