Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Myozenin 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Myozenin 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP153083
|
Novus Biologicals
NBP153083 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Myozenin 1 Polyclonal specifically detects Myozenin 1 in Human samples. It is validated for Western Blot.Specifications
| Myozenin 1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| calsarcin-2, CS-2, FATZ, Filamin-, actinin- and telethonin-binding protein, MYOZ, myozenin, myozenin 1, myozenin-1, Protein FATZ | |
| MYOZ1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NP98 | |
| 58529 | |
| Synthetic peptides corresponding to MYOZ1(myozenin 1) The peptide sequence was selected from the middle region of MYOZ1 (NP_067068). Peptide sequence TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title