Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NaGLT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $666.47
Specifications
| Antigen | NaGLT1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NaGLT1 Polyclonal specifically detects NaGLT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NaGLT1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 91749 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SGLNEYEEENEEEDAEKWNEMDFEMIETNDTMRHSIIETSRSSLTEPTAEVYNQYPSNALVFESSPFNTGSAHVKHLPETR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| KIAA1919, MGC33953, NaGLT1, sodium-dependent glucose transporter 1 | |
| KIAA1919 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title