NIR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB404750	Novus Biologicals NBP23413225UL	25 μL
NBP234132	Novus Biologicals NBP234132	0.1 mL

Description

NIR2 Polyclonal specifically detects NIR2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NIR2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: O00562
• Gene ID (Entrez): 9600
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Vision
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DRES9NIR-2, Drosophila retinal degeneration B homolog, FLJ44997, membrane-associated phosphatidylinositol transfer protein 1, NIR2PITPNM, phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2, PITPnm 1, Rd9, RDGB, RDGB1, RDGBA, RDGBA1, retinal degeneration B alpha 1
• Gene Symbols: PITPNM1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only