Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GABA-A R pi Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18239020UL
Description
GABA-A R pi Polyclonal specifically detects GABA-A R pi in Mouse samples. It is validated for Western Blot.Specifications
GABA-A R pi | |
Polyclonal | |
Western Blot 1:1000 | |
NP_666129 | |
GABRP | |
Synthetic peptide towards GABA A receptor pi. Peptide sequence GFENLTAGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLR. | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
GABA(A) receptor subunit pi, gamma-aminobutyric acid (GABA) A receptor, pi, gamma-aminobutyric acid receptor subunit pi, MGC126386, MGC126387 | |
Rabbit | |
Affinity Purified | |
RUO | |
2568 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction