Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM217A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | C6orf146 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM217A Polyclonal specifically detects FAM217A in Human samples. It is validated for Western Blot.Specifications
| C6orf146 | |
| Polyclonal | |
| Rabbit | |
| NP_775834 | |
| 222826 | |
| Synthetic peptide directed towards the middle region of human C6orf146. Peptide sequence ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf146, chromosome 6 open reading frame 146, family with sequence similarity 217, member A, hypothetical protein LOC222826 | |
| FAM217A | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title