Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM217A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C6orf146 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FAM217A Polyclonal specifically detects FAM217A in Human samples. It is validated for Western Blot.Specifications
C6orf146 | |
Polyclonal | |
Rabbit | |
NP_775834 | |
222826 | |
Synthetic peptide directed towards the middle region of human C6orf146. Peptide sequence ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C6orf146, chromosome 6 open reading frame 146, family with sequence similarity 217, member A, hypothetical protein LOC222826 | |
FAM217A | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title