Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LANCL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LANCL3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LANCL3 Polyclonal specifically detects LANCL3 in Human samples. It is validated for Western Blot.Specifications
LANCL3 | |
Polyclonal | |
Rabbit | |
NP_940913 | |
347404 | |
Synthetic peptide directed towards the C terminal of human LANCL3. Peptide sequence ICHGVAGSAYVFLLLYRLTGNSKYIYRAQSSFPVNLIKMEHLLYTRQHCF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ42925, LanC lantibiotic synthetase component C-like 3 (bacterial) | |
LANCL3 | |
IgG | |
43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title