Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Synaptotagmin 1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP19149920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP19149920 20 μL
NBP191499 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP19149920 Supplier Novus Biologicals Supplier No. NBP19149920UL

Rabbit Polyclonal Antibody

Synaptotagmin 1 Polyclonal specifically detects Synaptotagmin 1 in Mouse, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Synaptotagmin-1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_033332
Gene Alias DKFZp781D2042, p65, SVP65, synaptotagmin Isynaptotagmin 1, synaptotagmin-1, SYT, SytI
Gene Symbols SYT1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human Syt1. Peptide sequence FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL.
Molecular Weight of Antigen 47 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6857
Target Species Mouse, Bovine
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.