Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Synaptotagmin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19149920UL
Description
Synaptotagmin 1 Polyclonal specifically detects Synaptotagmin 1 in Mouse, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Synaptotagmin-1 | |
| Polyclonal | |
| Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000 | |
| NP_033332 | |
| SYT1 | |
| Synthetic peptide directed towards the middle region of human Syt1. Peptide sequence FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL. | |
| Affinity Purified | |
| RUO | |
| 6857 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp781D2042, p65, SVP65, synaptotagmin Isynaptotagmin 1, synaptotagmin-1, SYT, SytI | |
| Rabbit | |
| 47 kDa | |
| 20 μL | |
| Primary | |
| Mouse, Bovine | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction