Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
kinectin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | kinectin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19159220
|
Novus Biologicals
NBP19159220UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP191592
|
Novus Biologicals
NBP191592 |
100 μL |
Each for $487.50
|
|
|||||
Description
kinectin Polyclonal specifically detects kinectin in Human, Mouse samples. It is validated for Western Blot.Specifications
| kinectin | |
| Polyclonal | |
| Rabbit | |
| NP_001072990 | |
| 3895 | |
| Synthetic peptide directed towards the middle region of human KTN1. Peptide sequence EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| kinectin, kinectin 1 (kinesin receptor), MGC133337 | |
| KTN1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title