Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM106B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$519.67
Specifications
| Antigen | TMEM106B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TMEM106B Polyclonal specifically detects TMEM106B in Mouse samples. It is validated for Western Blot.Specifications
| TMEM106B | |
| Polyclonal | |
| Rabbit | |
| NP_082268 | |
| 54664 | |
| The specific Immunogen is proprietary information. Peptide sequence AEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| transmembrane protein 106B | |
| TMEM106B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title