Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FIBCD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | FIBCD1 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19136220
![]() |
Novus Biologicals
NBP19136220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP191362
![]() |
Novus Biologicals
NBP191362 |
100 μL |
Each for $487.50
|
|
|||||
Description
FIBCD1 Polyclonal specifically detects FIBCD1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
FIBCD1 | |
Unconjugated | |
RUO | |
fibrinogen C domain containing 1 | |
FIBCD1 | |
IgG |
Polyclonal | |
Rabbit | |
NP_116232 | |
84929 | |
Synthetic peptide directed towards the C terminal of human FIBCD1. Peptide sequence DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title