Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. non-muscle Myosin IIA Antibody, Novus Biologicals™

non-muscle Myosin IIA Antibody, Novus Biologicals™
SDP

Catalog No. p-200045623 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB406708 25ul
NBP185244 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB406708 Supplier Novus Biologicals Supplier No. NBP18524425UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

non-muscle Myosin IIA Polyclonal specifically detects non-muscle Myosin IIA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen non-muscle Myosin IIA
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Cellular myosin heavy chain, type A, DFNA17, EPSTS, FTNSNMMHC-IIA, MGC104539, MHANMMHC II-a, MYH9 variant protein, Myosin heavy chain 9, Myosin heavy chain, non-muscle IIa, myosin, heavy chain 9, non-muscle, myosin, heavy polypeptide 9, non-muscle, myosin-9, NMHC-II-A, NMMHCA, NMMHC-A, Non-muscle myosin heavy chain A, nonmuscle myosin heavy chain II-A, Non-muscle myosin heavy chain IIa, non-muscle myosin heavy polypeptide 9
Gene Symbols MYH9
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:REQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDF
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Cytoskeleton Markers
Primary or Secondary Primary
Gene ID (Entrez) 4627
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.