Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NRK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | NRK1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NRK1 Polyclonal specifically detects NRK1 in Human samples. It is validated for Western Blot.Specifications
NRK1 | |
Polyclonal | |
Rabbit | |
NP_060351 | |
54981 | |
Synthetic peptide directed towards the N terminal of human C9orf95The immunogen for this antibody is C9orf95. Peptide sequence QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
bA235O14.2, chromosome 9 open reading frame 95, EC 2.7.1.22, EC 2.7.1.n4, FLJ20559, nicotinamide riboside kinase 1, Nicotinic acid riboside kinase 1, NmR-K 1, NRK 1, NRK1, Ribosylnicotinamide kinase 1, Ribosylnicotinic acid kinase 1, RNK 1 | |
NMRK1 | |
IgG | |
23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title