Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OASL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | OASL |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191626
|
Novus Biologicals
NBP191626 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
OASL Polyclonal specifically detects OASL in Mouse samples. It is validated for Western Blot.Specifications
OASL | |
Polyclonal | |
Rabbit | |
NP_660210 | |
8638 | |
Synthetic peptide directed towards OASL. Peptide sequence ICLLDTISPEIQVFVKNPDGRSHAYAIHPLDYVLNLKQQIEDRQGLRCQE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
2'-5'-oligoadenylate synthetase-like, p59 OASL, p59OASL59 kDa 2'-5'-oligoadenylate synthase-like protein, Thyroid receptor-interacting protein 14,59 kDa 2'-5'-oligoadenylate synthetase-like protein, TRIP-14, TRIP14TR-interacting protein 14 | |
OASL | |
IgG | |
59 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title