Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OCIAD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OCIAD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OCIAD1 Polyclonal specifically detects OCIAD1 in Human samples. It is validated for Western Blot.Specifications
OCIAD1 | |
Polyclonal | |
Rabbit | |
Q9NX40 | |
54940 | |
Synthetic peptides corresponding to OCIAD1(OCIA domain containing 1) The peptide sequence was selected from the C terminal of OCIAD1. Peptide sequence QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Asrij, MGC111072, OCIA domain containing 1, OCIA domain-containing protein 1, OCIAFLJ20455, Ovarian carcinoma immunoreactive antigen, TPA018 | |
OCIAD1 | |
IgG | |
27 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title