Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ODAM Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB170126 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB170126 25 μg
NB170125 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB170126 Supplier Novus Biologicals Supplier No. NBP31752525UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Polyclonal Antibody

ODAM Polyclonal antibody specifically detects ODAM in Human samples. It is validated for Immunofluorescence

Specifications

Antigen ODAM
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias APIN, FLJ20513, odontogenic ameloblast-associated protein, odontogenic, ameloblast asssociated
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: PLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGY
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54959
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.