Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OR10A4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

OR10A4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB124591 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB124591 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB124591 Supplier Novus Biologicals Supplier No. NBP309845100UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

OR10A4 Polyclonal specifically detects OR10A4 in Human samples. It is validated for Western Blot.

Specifications

Antigen OR10A4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias HP2, hP2 olfactory receptor, JCG5, olfactory receptor 10A4, olfactory receptor OR11-87, olfactory receptor, family 10, subfamily A, member 4, olfactory receptor, family 10, subfamily A, member 4 pseudogene, Olfactory receptor-like protein JCG5, OR10A4P
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10A4 (NP_997069). Peptide sequence TAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKAALKR
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 283297
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.