Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR10A4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | OR10A4 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR10A4 Polyclonal specifically detects OR10A4 in Human samples. It is validated for Western Blot.Specifications
| OR10A4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| HP2, hP2 olfactory receptor, JCG5, olfactory receptor 10A4, olfactory receptor OR11-87, olfactory receptor, family 10, subfamily A, member 4, olfactory receptor, family 10, subfamily A, member 4 pseudogene, Olfactory receptor-like protein JCG5, OR10A4P | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR10A4 (NP_997069). Peptide sequence TAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKAALKR | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 283297 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title