Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAK1 interacting protein 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP190029
Description
PAK1 interacting protein 1 Polyclonal specifically detects PAK1 interacting protein 1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PAK1 interacting protein 1 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
bA421M1.5, FLJ20624, hPIP1WD repeat-containing protein 84, MAK11, p21-activated protein kinase-interacting protein 1, PAK1 interacting protein 1, PIP1PAK/PLC-interacting protein 1, RP11-421M1.5, WDR84PAK1-interacting protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
55003 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PAK1IP1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKES | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction