Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PAPD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	PAPD4
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16906020 View Documents View Product Certificates	Novus Biologicals NBP16906020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP169060 View Documents View Product Certificates	Novus Biologicals NBP169060	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PAPD4 Polyclonal specifically detects PAPD4 in Rat samples. It is validated for Western Blot.

Specifications

Antigen	PAPD4
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q5U315
Gene ID (Entrez)	167153
Isotype	IgG
Molecular Weight of Antigen	56 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	EC 2.7.7.19, FLJ38499, GLD2TUTase 2, hGLD-2, PAP associated domain containing 4, PAP-associated domain-containing protein 4, poly(A) RNA polymerase GLD2, Terminal uridylyltransferase 2
Immunogen	Synthetic peptides corresponding to Papd4 (PAP associated domain containing 4) The peptide sequence was selected from the C terminal of Papd4. Peptide sequence YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PAPD4 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents