Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAPD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP153057
Description
PAPD4 Polyclonal specifically detects PAPD4 in Human samples. It is validated for Western Blot.Specifications
PAPD4 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 2.7.7.19, FLJ38499, GLD2TUTase 2, hGLD-2, PAP associated domain containing 4, PAP-associated domain-containing protein 4, poly(A) RNA polymerase GLD2, Terminal uridylyltransferase 2 | |
Rabbit | |
Affinity purified | |
RUO | |
167153 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q6PIY7 | |
TENT2 | |
Synthetic peptides corresponding to PAPD4(PAP associated domain containing 4) The peptide sequence was selected from the N terminal of PAPD4. Peptide sequence GRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHT. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction