Paralemmin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179624

Catalog No. NBP179624

Description

Paralemmin Polyclonal specifically detects Paralemmin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Paralemmin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0270, paralemmin
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 5064
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_001035224
• Gene Symbols: PALM
• Immunogen: Synthetic peptide directed towards the N terminal of human PALM. Peptide sequence LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 79%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit
• Isotype: IgG