Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PARP4 Antibody, Novus Biologicals™

PARP4 Antibody, Novus Biologicals™
SDP

Catalog No. p-200043438 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430831 25 μL
NBP189232 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB430831 Supplier Novus Biologicals Supplier No. NBP18923225UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PARP4 Polyclonal specifically detects PARP4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PARP4
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 193 kDa vault protein, ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)-like 1, ADPRTL1I-alpha-I-related, EC 2.4.2.30, H5 proline-rich, p193, PARP-4, PARPL, PARP-related, PARP-related/IalphaI-related H5/proline-rich, PH5P, poly (ADP-ribose) polymerase family, member 4, poly [ADP-ribose] polymerase 4, poly(ADP-ribose) synthetase, poly(ADP-ribosyl)transferase-like 1, Vault poly(ADP-ribose) polymerase, vault protein, 193-kDa, VAULT3, von Willebrand factor A domain containing 5C, VPARPKIAA0177, VWA5C
Gene Symbols PARP4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEGILLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVCETNLSKPNPPSLAKYRALRCKIEHVEQNTEEF
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, DNA Repair, Hypoxia
Primary or Secondary Primary
Gene ID (Entrez) 143
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.