Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PCGF6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	PCGF6
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15537220 View Documents View Product Certificates	Novus Biologicals NBP15537220UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP155372 View Documents View Product Certificates	Novus Biologicals NBP155372	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PCGF6 Polyclonal specifically detects PCGF6 in Human samples. It is validated for Western Blot.

Specifications

Antigen	PCGF6
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Zinc Finger
Gene Accession No.	Q9BYE7
Gene ID (Entrez)	84108
Immunogen	Synthetic peptides corresponding to the middle region of human PCGF6 (polycomb group ring finger 6)(NP_115530). Peptide sequence: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	MBLRMel18 and Bmi1-like RING finger protein, MGC15678, MGC17541, polycomb group ring finger 6, RING finger protein 134polycomb group RING finger protein 6, RNF134Mel18 and Bmi1-like RING finger
Gene Symbols	PCGF6
Isotype	IgG
Molecular Weight of Antigen	30 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PCGF6 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents