Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PDX-1/IPF1 Antibody, Novus Biologicals™

PDX-1/IPF1 Antibody, Novus Biologicals™
SDP

Catalog No. NB436075 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436075 25 μL
NBP238865 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436075 Supplier Novus Biologicals Supplier No. NBP23886525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

PDX-1/IPF1 Polyclonal specifically detects PDX-1/IPF1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PDX-1/IPF1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P52945
Gene Alias Glucose-sensitive factor, IDX-1GSF, Insulin promoter factor 1, insulin promoter factor 1, homeodomain transcription factor, Insulin upstream factor 1, IPF1pancreas/duodenum homeobox protein 1, Islet/duodenum homeobox-1, MODY4IUF1, pancreatic and duodenal homeobox 1, pancreatic-duodenal homeobox factor 1, PDX-1IPF-1, somatostatin transcription factor 1, Somatostatin-transactivating factor 1, STF-1IUF-1
Gene Symbols PDX1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: DISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3651
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.