Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PDZRN4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PDZRN4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154925
|
Novus Biologicals
NBP154925 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15492520
|
Novus Biologicals
NBP15492520UL |
20 μL | N/A | N/A | N/A | ||||
Description
PDZRN4 Polyclonal specifically detects PDZRN4 in Human samples. It is validated for Western Blot.Specifications
| PDZRN4 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| DKFZp434B0417, IMAGE5767589, Ligand of Numb protein X 4, LNX4FLJ33777, PDZ domain containing ring finger 4, PDZ domain-containing RING finger protein 4, SAMCAP3L, SEMACAP3-like protein, SEMCAP3L | |
| PDZRN4 | |
| IgG | |
| 89 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B4DG65 | |
| 29951 | |
| Synthetic peptides corresponding to PDZRN4(PDZ domain containing ring finger 4) The peptide sequence was selected from the N terminal of PDZRN4. Peptide sequence SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title