PFKFB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179635

Catalog No. NBP179635

Description

PFKFB2 Polyclonal specifically detects PFKFB2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PFKFB2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 6PF-2-K/Fru-2,6-P2ase 2, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, DKFZp781D2217, fructose-2,6-bisphosphatase, cardiac isozyme, MGC138308,6PF-2-K/Fru-2,6-P2ase heart-type isozyme, MGC138310, PFK/FBPase 2, PFK-2/FBPase-2, PFKFB, cardiac
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 86%; Yeast: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_032851
• Gene Symbols: PFKFB2
• Immunogen: Synthetic peptide directed towards the C terminal of human Pfkfb2The immunogen for this antibody is Pfkfb2. Peptide Sequence: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5208
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.