Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PFKL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156607
Description
PFKL Polyclonal specifically detects PFKL in Human, Mouse samples. It is validated for Western Blot.Specifications
| PFKL | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 6-phosphofructokinase, liver type, DKFZp686G1648, DKFZp686L2097, EC 2.7.1, EC 2.7.1.11, FLJ30173, FLJ40909, human liver-type 1-phosphofructokinase, EC 2.7.1.1110Phosphohexokinase, liver-type 1-phosphofructokinase, PFK-B, Phosphofructo-1-kinase isozyme B, Phosphofructokinase 1, phosphofructokinase, liver, phosphohexokinase | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q7L2M7 | |
| PFKL | |
| Synthetic peptides corresponding to PFKL(phosphofructokinase, liver) The peptide sequence was selected from the middle region of PFKL. Peptide sequence RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA. | |
| 100 μL | |
| Lipid and Metabolism | |
| 5211 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction