PFKL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156607

Catalog No. NBP156607

Description

PFKL Polyclonal specifically detects PFKL in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PFKL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 6-phosphofructokinase, liver type, DKFZp686G1648, DKFZp686L2097, EC 2.7.1, EC 2.7.1.11, FLJ30173, FLJ40909, human liver-type 1-phosphofructokinase, EC 2.7.1.1110Phosphohexokinase, liver-type 1-phosphofructokinase, PFK-B, Phosphofructo-1-kinase isozyme B, Phosphofructokinase 1, phosphofructokinase, liver, phosphohexokinase
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7L2M7
• Gene Symbols: PFKL
• Immunogen: Synthetic peptides corresponding to PFKL(phosphofructokinase, liver) The peptide sequence was selected from the middle region of PFKL. Peptide sequence RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 5211
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG