Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PFKL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$501.50
Specifications
Antigen | PFKL |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
PFKL Polyclonal specifically detects PFKL in Human, Mouse samples. It is validated for Western Blot.Specifications
PFKL | |
Polyclonal | |
Purified | |
RUO | |
Q7L2M7 | |
5211 | |
Synthetic peptides corresponding to PFKL(phosphofructokinase, liver) The peptide sequence was selected from the middle region of PFKL. Peptide sequence RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA. | |
Primary |
Western Blot | |
Unconjugated | |
Rabbit | |
Lipid and Metabolism | |
6-phosphofructokinase, liver type, DKFZp686G1648, DKFZp686L2097, EC 2.7.1, EC 2.7.1.11, FLJ30173, FLJ40909, human liver-type 1-phosphofructokinase, EC 2.7.1.1110Phosphohexokinase, liver-type 1-phosphofructokinase, PFK-B, Phosphofructo-1-kinase isozyme B, Phosphofructokinase 1, phosphofructokinase, liver, phosphohexokinase | |
PFKL | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title