Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Phospholipase C beta 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Phospholipase C beta 2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Phospholipase C beta 2 Polyclonal specifically detects Phospholipase C beta 2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Phospholipase C beta 2 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism, Wnt Signaling Pathway | |
EC 3.1.4.11, FLJ38135, Phosphoinositide phospholipase C-beta-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2, phospholipase C, beta 2, Phospholipase C-beta-2, PLC-beta-2 | |
PLCB2 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
5330 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKESVRACLRTCFPSEAKDKPERACECPPELCEQDPL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title