Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PI 3-Kinase p55 gamma Antibody, Novus Biologicals™
SDP

Catalog No. NBP158332 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158332 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158332 Supplier Novus Biologicals Supplier No. NBP158332
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PI 3-Kinase p55 gamma Polyclonal specifically detects PI 3-Kinase p55 gamma in Human samples. It is validated for Western Blot.

Specifications

Antigen PIK3R3
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q92569
Gene Alias 100% homology to SWISS-PROT Q92569, DKFZp686P05226, FLJ41892, p55, Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, phosphoinositide-3-kinase, regulatory subunit 3 (gamma), phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma), phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma), PI3K regulatory subunit gamma, PI3-kinase subunit p55-gamma, regulatory subunit, polypeptide 3 (p55, gamma)
Gene Symbols PIK3R3
Host Species Rabbit
Immunogen PI 3-Kinase p55 gamma Antibody is made to synthetic peptides corresponding to PIK3R3(phosphoinositide-3-kinase, regulatory subunit 3 (gamma)) The peptide sequence was selected from the middle region of PIK3R3. Peptide sequence EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE. The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 54 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Diabetes Research, mTOR Pathway, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8503
Test Specificity PI 3-Kinase p55 gamma Antibody is specific to Subunit or Isoform: gamma.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.