PI 3-Kinase p55 gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158332

Catalog No. NBP158332

Description

PI 3-Kinase p55 gamma Polyclonal specifically detects PI 3-Kinase p55 gamma in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PIK3R3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 100% homology to SWISS-PROT Q92569, DKFZp686P05226, FLJ41892, p55, Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, phosphoinositide-3-kinase, regulatory subunit 3 (gamma), phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma), phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma), PI3K regulatory subunit gamma, PI3-kinase subunit p55-gamma, regulatory subunit, polypeptide 3 (p55, gamma)
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Diabetes Research, mTOR Pathway, Neuroscience, Signal Transduction
• Gene ID (Entrez): 8503
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q92569
• Gene Symbols: PIK3R3
• Immunogen: PI 3-Kinase p55 gamma Antibody is made to synthetic peptides corresponding to PIK3R3(phosphoinositide-3-kinase, regulatory subunit 3 (gamma)) The peptide sequence was selected from the middle region of PIK3R3. Peptide sequence EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE. The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: PI 3-Kinase p55 gamma Antibody is specific to Subunit or Isoform: gamma.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified