Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIK3R5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | PIK3R5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156922
|
Novus Biologicals
NBP156922 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP15692220
|
Novus Biologicals
NBP15692220UL |
20 μL | N/A | N/A | N/A | ||||
Description
PIK3R5 Polyclonal specifically detects PIK3R5 in Human, Mouse samples. It is validated for Western Blot.Specifications
| PIK3R5 | |
| Polyclonal | |
| Rabbit | |
| Q8WYR1 | |
| 23533 | |
| Synthetic peptides corresponding to PIK3R5(phosphoinositide-3-kinase, regulatory subunit 5) The peptide sequence was selected from the N terminal of PIK3R5. Peptide sequence HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| F730038I15Rik, FOAP-2, p101, P101-PI3K, Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit, phosphoinositide-3-kinase, regulatory subunit 5, phosphoinositide-3-kinase, regulatory subunit, polypeptide p101, PI3-kinase p101 subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, regulatory subunit 5, p101 | |
| PIK3R5 | |
| IgG | |
| This product is specific to Subunit or Isoform: 5. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title