PIMT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25679025UL

Catalog No. NB394311

Description

PIMT Polyclonal specifically detects PIMT in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PIMT
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Cap-specific guanine-N2 methyltransferase, CLL-associated antigen KW-2, DKFZp762A163, EC 2.1.1, EC 2.1.1.-, HCA137, Hepatocellular carcinoma-associated antigen 137, NCOA6IPSEREX-defined, nuclear receptor coactivator 6 interacting protein, Nuclear receptor coactivator 6-interacting protein, PIMTFLJ22995, PIPMT, PRIP-interacting protein PIPMT, PRIP-interacting protein with methyltransferase domain, PRIP-interacting protein with methyltransferase motif, trimethylguanosine synthase, trimethylguanosine synthase 1, trimethylguanosine synthase homolog, trimethylguanosine synthase homolog (S. cerevisiae)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TGS1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVD
• Quantity: 25 μL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 96764
• Target Species: Human
• Form: Purified

For Research Use Only