Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PINCH1/LIMS1 Antibody, Novus Biologicals™

PINCH1/LIMS1 Antibody, Novus Biologicals™
SDP

Catalog No. NB396293 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396293 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396293 Supplier Novus Biologicals Supplier No. NBP24685125UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PINCH1/LIMS1 Polyclonal antibody specifically detects PINCH1/LIMS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen PINCH1/LIMS1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. B4DPH6
Gene Alias LIM and senescent cell antigen-like domains 1, LIM and senescent cell antigen-like-containing domain protein 1, PINCH-1, PINCHPINCH1Particularly interesting new Cys-His protein 1, Renal carcinoma antigen NY-REN-48
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVY
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3987
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.