Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PINCH1/LIMS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | PINCH1/LIMS1 |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PINCH1/LIMS1 Polyclonal antibody specifically detects PINCH1/LIMS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
PINCH1/LIMS1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
B4DPH6 | |
3987 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Purified | |
RUO | |
PBS (pH 7.2), 40% Glycerol | |
LIM and senescent cell antigen-like domains 1, LIM and senescent cell antigen-like-containing domain protein 1, PINCH-1, PINCHPINCH1Particularly interesting new Cys-His protein 1, Renal carcinoma antigen NY-REN-48 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVY | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title