Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pirh2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Pirh2 |
---|---|
Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Pirh2 Polyclonal specifically detects Pirh2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Pirh2 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Androgen receptor N-terminal-interacting protein, androgen-receptor N-terminal-interacting protein, ARNIPRING finger protein 199, CHIMPRNF199DKFZp586C1620, CH-rich interacting match with PLAG1, CH-rich-interacting match with PLAG1, E3 ubiquitin-protein ligase Pirh2, EC 6.3.2.-, hARNIP, hPirh2, PIRH2, PRO1996, ring finger and CHY zinc finger domain containing 1, RING finger and CHY zinc finger domain-containing protein 1, Zinc finger protein 363p53-induced RING-H2 protein, ZNF363 | |
RCHY1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Apoptosis, Breast Cancer, Cancer, p53 Pathway, Tumor Suppressors, Ubiquitin Proteasome Pathway, Zinc Finger | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
25898 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title