PNCK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB431796	Novus Biologicals NBP18665225UL	25 μL
NBP186652	Novus Biologicals NBP186652	0.1 mL

Description

PNCK Polyclonal specifically detects PNCK in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PNCK
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Protein Kinase
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 139728
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISHPN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: BSTK3, calcium/calmodulin-dependent protein kinase type 1B, CaM kinase I beta, CaM kinase IB, CaMK1b, CaM-KI beta, CaMKI-beta, EC 2.7.11, EC 2.7.11.17, FLJ50403, FLJ50549, FLJ56451, FLJ59811, MGC45419, pregnancy up-regulated non-ubiquitously expressed CaM kinase, pregnancy upregulated non-ubiquitously expressed CaM kinase, Pregnancy up-regulated non-ubiquitously-expressed CaM kinase
• Gene Symbols: PNCK
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only