Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POU3F2/OCT7 Antibody (CL6232), Novus Biologicals™

Mouse Monoclonal Antibody
$254.42 - $678.13
Specifications
| Antigen | POU3F2/OCT7 |
|---|---|
| Clone | CL6232 |
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
Description
POU3F2/OCT7 Monoclonal specifically detects POU3F2/OCT7 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| POU3F2/OCT7 | |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Human, Mouse, Rat | |
| 5454 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP | |
| Primary | |
| Specificity of human POU3F2/OCT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| CL6232 | |
| Monoclonal | |
| Purified | |
| Transcription Factors and Regulators | |
| Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3 | |
| POU3F2 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title