Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PP2C gamma/PPM1G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18724625UL
Description
PP2C gamma/PPM1G Polyclonal specifically detects PP2C gamma/PPM1G in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| PP2C gamma/PPM1G | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Knockdown Validated | |
| EC 3.1.3.16, MGC1675, MGC2870, PP2C, gamma, PP2CG, PP2C-gamma, PP2CGAMMA, PPM1C, PPP2CG, Protein phosphatase 1C, protein phosphatase 1G, protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform, protein phosphatase 2, catalytic subunit, gamma isoform, protein phosphatase 2C gamma isoform, Protein phosphatase 2C isoform gamma, Protein phosphatase magnesium-dependent 1 gamma, protein phosphatase, Mg2+/Mn2+ dependent, 1G | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PPM1G | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD | |
| 25 μL | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| 5496 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction