Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PP2C gamma/PPM1G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$416.50 - $682.00
Specifications
| Antigen | PP2C gamma/PPM1G |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PP2C gamma/PPM1G Polyclonal specifically detects PP2C gamma/PPM1G in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| PP2C gamma/PPM1G | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| EC 3.1.3.16, MGC1675, MGC2870, PP2C, gamma, PP2CG, PP2C-gamma, PP2CGAMMA, PPM1C, PPP2CG, Protein phosphatase 1C, protein phosphatase 1G, protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform, protein phosphatase 2, catalytic subunit, gamma isoform, protein phosphatase 2C gamma isoform, Protein phosphatase 2C isoform gamma, Protein phosphatase magnesium-dependent 1 gamma, protein phosphatase, Mg2+/Mn2+ dependent, 1G | |
| PPM1G | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5496 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title