Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPAR alpha/NR1C1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | PPAR alpha/NR1C1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PPAR alpha/NR1C1 Polyclonal specifically detects PPAR alpha/NR1C1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| PPAR alpha/NR1C1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Lipid and Metabolism, mTOR Pathway, Transcription Factors and Regulators | |
| alpha, hPPAR, NR1C1MGC2237, Nuclear receptor subfamily 1 group C member 1, peroxisome proliferator-activated receptor alpha, PPARalpha, PPAR-alpha, PPARMGC2452 | |
| PPARA | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5465 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title