Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP1R11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | PPP1R11 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1706820
![]() |
Novus Biologicals
NBP17068120UL |
20 μL |
Each for $206.00
|
|
|||||
NBP170681
![]() |
Novus Biologicals
NBP170681 |
100 μL |
Each for $487.50
|
|
|||||
Description
PPP1R11 Polyclonal specifically detects PPP1R11 in Human samples. It is validated for Western Blot.Specifications
PPP1R11 | |
Polyclonal | |
Rabbit | |
HCG V, HCG-V, inhibitor-3, IPP3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, TCTE5, TCTEX5 | |
PPP1R11 | |
IgG | |
This product is specific to Subunit or Isoform: 11. |
Western Blot | |
Unconjugated | |
RUO | |
6992 | |
Synthetic peptides corresponding to PPP1R11(protein phosphatase 1, regulatory (inhibitor) subunit 11) The peptide sequence was selected from the N terminal of PPP1R11. Peptide sequence MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title