PPP1R12C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB405057	Novus Biologicals NBP19407925UL	25 μL
NBP194079	Novus Biologicals NBP194079	0.1 mL

Description

PPP1R12C Polyclonal specifically detects PPP1R12C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPP1R12C
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 54776
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: DKFZp434D0412, LENG3, leukocyte receptor cluster (LRC) encoded novel gene 3, leukocyte receptor cluster (LRC) member 3, MBS85, myosin-binding subunit 85, p84, p85, protein phosphatase 1 myosin-binding subunit of 85 kDa, protein phosphatase 1 myosin-binding subunit p85, protein phosphatase 1 regulatory subunit 12C, protein phosphatase 1, regulatory (inhibitor) subunit 12C, protein phosphatase 1, regulatory subunit 12C
• Gene Symbols: PPP1R12C
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only