PPP1R3A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB169339	Novus Biologicals NBP31713125UL	25 μg
NB169338	Novus Biologicals NBP317131100UL	100 μg

Description

PPP1R3A Polyclonal antibody specifically detects PPP1R3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PPP1R3A
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle, GM, PP1G, PPP1R3, protein phosphatase 1 glycogen- associated regulatory subunit, Protein phosphatase 1 glycogen-associated regulatory subunit, protein phosphatase 1 regulatory subunit 3A, protein phosphatase 1, regulatory (inhibitor) subunit 3A, protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen andsarcoplasmic reticulum binding subunit, skeletal muscle), Protein phosphatase type-1 glycogen targeting subunit, RG1, serine/threonine specific protein phosphatase, type-1 protein phosphatase skeletal muscle glycogen targeting subunit
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EETTSNMGEIKPSLGDTSSDELVQLHTGSKEVLDDNANPAHGNGTMQIPCPSSDQLMAGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTSACLKESTEEG
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, 40% glycerol
• Gene ID (Entrez): 5506
• Isotype: IgG
• Purification Method: Affinity purified